PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.2H7DH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 385aa    MW: 43473 Da    PI: 4.7738
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.2H7DHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.34.7e-106097746
                     HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Aradu.2H7DH 60 EEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 97
                     9***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-9543IPR009057Homeodomain-like
PROSITE profilePS5129413.6379103IPR017930Myb domain
SuperFamilySSF466895.35E-161195IPR009057Homeodomain-like
SMARTSM007177.1E-1213101IPR001005SANT/Myb domain
CDDcd001674.08E-81699No hitNo description
Gene3DG3DSA:1.10.10.604.7E-1660100IPR009057Homeodomain-like
PfamPF002492.1E-86097IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAALKAYIE KNGTGGNWIA LPQKIGIYII LFYNQYIVME  60
EDNIICSLYI SIGSRWSIIA AQLPGRTDND IKNYWNTRLK KKLLGRRKQS SFNSSKDSNI  120
GMQDDTSCSN NNSNALSTSA LERLQLHMQL QSLQNPFSFY TNPALWPKLH PFQEKMIHHN  180
LQQQQHQSHN LNSHDSNSNN PLMQNTNNAL LSPHHHVLNQ EEGEKDTKNS KVDLLENPLN  240
SNGCSSVLFN NSNPLLHSSS DAIIAPRGDG VEGIQQVCAI QSELDEILNL NSNRRMCYIP  300
QEEEEEEEDQ IQQMADDEFD CLREMNSNNN NNGNSKDSNS NLIWWSNDSS ADTKSASSNS  360
WESMSSTPVL LPEGMFQDYE LGYTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-39AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015933695.10.0PREDICTED: transcription factor MYB36
TrEMBLA0A0L9TF411e-131A0A0L9TF41_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R8251e-131A0A0S3R825_PHAAN; Uncharacterized protein
TrEMBLV7CBY01e-131V7CBY0_PHAVU; Uncharacterized protein
STRINGGLYMA13G01200.11e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.19e-61myb domain protein 36